Analytical Data
-
Gene name
FATE1
- Application
-
Alternative Names
FATE1; FATE; Fetal and adult testis-expressed transcript protein; Cancer/testis antigen 43; CT43; Tumor antigen BJ-HCC-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969F0
-
Expression Region
1-183aa
-
AA Sequence
MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ
-
Molecular Weight
47.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FATE1 (Fas apoptotic inhibitory molecule 1) is a critical protein involved in regulating apoptosis, particularly by modulating the Fas signaling pathway, which is essential for immune system homeostasis. Research on FATE1 has garnered attention due to its potential implications in various diseases, including cancers and autoimmune disorders. The protein acts as an inhibitor by interacting with Fas and preventing the activation of downstream apoptotic signals, thereby promoting cell survival. Understanding the structure and function of FATE1, especially through recombinant protein studies, has opened avenues for exploring its role in therapeutic applications, such as developing targeted treatments that manipulate apoptotic pathways to enhance cell viability in certain contexts. Recent advancements in recombinant DNA technology have enabled the efficient production of FATE1, facilitating detailed biochemical and biophysical characterization of the protein. These studies aim to elucidate the molecular mechanisms through which FATE1 exerts its effects, potentially leading to innovative strategies for modulating apoptosis in diseases characterized by dysregulated cell death. As such, the exploration of FATE1 and its signaling pathways represents a promising area of research with significant implications for both basic biology and clinical medicine.
