Analytical Data
-
Gene name
ZNF519
- Application
-
Alternative Names
ZNF519Zinc finger Protein 519
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TB69
-
Expression Region
1-540 aa
-
AA Sequence
MELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLAVYSYYNQGILPEQGIQDSFKKATLGRYGSCGLENICLWKNWESIGEGEGQKECYNLCSQYLTTSHNKHLTVKGDKEYRIFQKKPQFLSAAPTEPCIPMNKYQHKFLKSVFCNKNQINFNHDSDISKHHSTHFLENYYNCNECEKVFYQSSKLIFPENIHIQEKPYNSNECGETSDPFSKLTQHQRIYIGESSQRCNKKCIIVFSQSHLKGHKIINTGEKSVKYKERGKAFTRGLHLGHQKIHTGEKPYKCKKCDKAFNKSSHLAQHQRIHTGEKPFKCKECGKAFNRGSYLTQHQRIHTGERAFKCEECGKAFNRGSYLTQHQRIHTGEKPFRCKECGKAFNRSSYVTQHQRMHTGEKPFKCKECGKAFNRASHLTQHQRIHTGEKHFKCKECGKAFNRGSHLTRHQRIHTGEKSFKCEECGKAFIWGSHLTQHQRVHTGEKFFKCKECGKAFTRSSHLTQHQRIHTGEKPFKCKECGKAFNRRSTLTQHQIIHTR
-
Molecular Weight
89.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Zinc finger protein 519 (ZNF519) is a member of the zinc finger protein family, known for its role in gene regulation and cellular processes. Recent studies have suggested that ZNF519 may be involved in various biological functions, including cell differentiation, apoptosis, and stress response, and it has been implicated in certain pathological conditions, such as cancer and neurodegenerative diseases. Research has increasingly focused on understanding the structure and function of ZNF519 to elucidate its mechanisms of action and potential therapeutic applications. The production of recombinant ZNF519 protein is critical for these studies, as it allows for detailed biochemical characterization and functional assays. Recombinant protein production typically involves the use of expression systems, such as bacterial or eukaryotic cells, to generate a sufficient quantity of the protein for studies. By investigating ZNF519 through recombinant technology, researchers aim to uncover its interactions with other cellular molecules, its impact on transcriptional regulation, and its potential as a biomarker or target for drug development. This research not only furthers our understanding of ZNF519's biological roles but also opens new avenues for therapeutic interventions in diseases associated with dysregulated zinc finger proteins.
