Analytical Data
-
Gene name
GAL
- Application
-
Alternative Names
GAL;Galactose-1-phosphate uridylyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22466
-
Expression Region
44-123aa
-
AA Sequence
GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
-
Molecular Weight
16.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GAL (Galanin) is a neuropeptide that plays a critical role in various physiological processes, including pain modulation, appetite regulation, and mood control. Research into GAL and its receptor interactions has garnered significant attention due to its potential implications in neurodegenerative diseases, mood disorders, and obesity. The use of recombinant technology to produce GAL proteins allows for the detailed study of their structure-function relationships, enabling scientists to investigate how GAL modulates receptor activity and downstream signaling pathways. These insights could reveal novel therapeutic targets for treating conditions linked to GAL dysregulation. Advances in techniques such as CRISPR gene editing and high-throughput screening are paving the way for more sophisticated investigations into GAL's role in the central nervous system. Furthermore, the ability to produce GAL in recombinant forms facilitates the exploration of its pharmacokinetics, receptor binding affinities, and potential as a biomarker in various diseases. Overall, GAL recombinant protein research is poised to contribute significantly to our understanding of neurobiology and the development of innovative treatments for related disorders.











