Analytical Data
-
Gene name
TSC2
- Application
-
Alternative Names
FLJ43106; LAM; OTTHUMP00000158940; OTTHUMP00000198394; OTTHUMP00000198395; PPP1R160; Protein phosphatase 1; regulatory subunit 160; TSC complex subunit 2; tsc2; TSC2_HUMAN; TSC4; TSC4 gene; formerly; TSC4; formerly; Tuberin; Tuberous sclerosis 2; Tuberous sclerosis 2 Protein; Tuberous sclerosis 2 Protein homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49815
-
Expression Region
540-658 aa
-
AA Sequence
SPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFLFLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKK
-
Molecular Weight
38.83 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSC2 (Tuberous Sclerosis Complex 2) is a critical tumor suppressor gene involved in the regulation of cell growth and proliferation, playing a key role in the Tuberous Sclerosis Complex (TSC), a genetic disorder characterized by the development of benign tumors in multiple organs. Mutations in TSC2 disrupt the signaling pathways that control cellular metabolism and growth, leading to various clinical manifestations, including neurological disorders and renal tumors. The TSC2 protein, together with its partner TSC1, forms a heterodimer that inhibits the mammalian target of rapamycin (mTOR) pathway, a central regulator of cell growth. Research on recombinant TSC2 proteins has garnered significant interest as it provides insights into the molecular mechanisms underlying TSC and related diseases. Recombinant TSC2 proteins are utilized to study protein function, interaction with TSC1, and the modulation of mTOR signaling. Understanding the structure and function of TSC2 can aid in the development of targeted therapies for TSC and other cancers characterized by dysregulated mTOR activity. Furthermore, by analyzing the effects of TSC2 mutations on protein function and mTOR signaling, researchers aim to establish a link between specific genetic alterations and clinical outcomes, advancing the field of precision medicine. Overall, ongoing studies on TSC2 recombinant proteins not only enhance our understanding of its biological roles but also pave the way for novel therapeutic strategies in tackling TSC and related malignancies.
