Analytical Data
-
Gene name
MBL
- Application
-
Alternative Names
MBL；COLEC1；MBL；Mannose-binding Protein C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11226
-
Expression Region
21-248aa
-
AA Sequence
ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAE NGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDE DCVLLLKNGQWNDVPCSTSHLAVCEFPIVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of MBL (Mannose-Binding Lectin) recombinant proteins has gained significant attention in recent years due to their critical role in the immune system. MBL is a type of lectin that binds to mannose residues on the surface of pathogens, facilitating opsonization and subsequent clearance by immune cells. Deficiencies or polymorphisms in the MBL gene have been associated with increased susceptibility to various infections and autoimmune diseases, highlighting its importance in host defense. The production of MBL as a recombinant protein allows for detailed structural and functional studies, enabling researchers to investigate its binding properties, immune interactions, and potential therapeutic applications. Recombinant MBL can also serve as a valuable tool for studying carbohydrate-protein interactions and for developing diagnostic assays. Furthermore, understanding the modulation of MBL's activity and its role in the complement activation pathway may lead to novel strategies for enhancing immune responses in immunocompromised individuals. As a result, research into MBL recombinant proteins is not only crucial for advancing our understanding of innate immunity but also for exploring potential interventions for infectious and inflammatory diseases.
