Analytical Data
-
Gene name
ZNF509
- Application
-
Alternative Names
Zinc finger and BTB domain-containing Protein 49. Zinc finger Protein 509
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZSB9
-
Expression Region
1-248 aa
-
AA Sequence
MQRKLVKHRIRHTGERPYSCSACGKCFGGSGDLRRHVRTHTGEKPYTCEICNKCFTRSAVLRRHKKMHCKAGDESPDVLEELSQAIETSDLEKSQSSDSFSQDTSVTLMPVSVKLPVHPVENSVVEFDSHSGGSYCKLRSMIQPHGVSDQEKLSLDPGKLAKPQMQQTQPQAYAYSDVDTPAGGEPLQADGMAMIRSSLAALDNHGGDPLGSRASSTTYRNSEGQFFSSMTLWGLAMKTLQNENELDQ
-
Molecular Weight
53.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF509 is a member of the zinc finger protein family, which plays a crucial role in various cellular processes, including gene regulation and DNA repair. Recent studies have highlighted its potential involvement in cancer biology, particularly in the context of tumors where its expression is dysregulated. Researchers have pointed out that ZNF509 may act as a transcription factor, influencing the expression of genes associated with cell proliferation and apoptosis. Given its significant role, the generation of ZNF509 recombinant proteins has become a key focus for scientists aiming to elucidate its functional mechanisms. By producing ZNF509 in a controlled laboratory setting, researchers can delve into its structural properties, interaction with DNA, and post-translational modifications. Furthermore, understanding how ZNF509 interacts with other cellular factors may shed light on its contribution to oncogenic processes and its potential as a therapeutic target. As cancer continues to be a leading cause of mortality worldwide, the investigation of ZNF509 not only enriches the field of molecular biology but also offers promising avenues for developing novel cancer treatment strategies. Thus, the exploration of ZNF509 recombinant proteins is of paramount importance to unlock the complexities of its biological functions and therapeutic applications.
