Analytical Data
-
Gene name
MRC2
- Application
-
Alternative Names
MRC2；CLEC13E；ENDO180；KIAA0709；C-type mannose receptor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBG0
-
Expression Region
105-214aa
-
AA Sequence
ASLGMYECDREALNLRWHCRTLGDQLSLLLGARTSNISKPGTLERGDQTR SGQWRIYGSEEDLCALPYHEVYTIQGNSHGKPCTIPFKYDNQWFHGCTST GREDGHLWCA
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRC2, also known as the mannose receptor C-type 2, is a crucial protein involved in various biological processes, including immune response and tissue remodeling. Its role as a receptor for extracellular matrix components and as a mediator of macrophage and dendritic cell functions has garnered significant interest in recent years. Research indicates that MRC2 is implicated in the uptake of glycoproteins and glycosylated ligands, influencing the phagocytosis of pathogens and cellular debris, thus contributing to homeostasis and inflammation. Moreover, aberrations in MRC2 expression have been associated with various diseases, including fibrosis, cancer, and autoimmune disorders, highlighting its potential as a therapeutic target. The structural characteristics and functional mechanisms of MRC2 must be thoroughly understood to exploit its capabilities in clinical applications. Consequently, the study of MRC2 recombinant proteins has become essential for elucidating its role in pathophysiology and exploring innovative treatments through targeted therapies. This research can also lead to advancements in vaccine development, enhancing the body’s ability to mount effective immune responses against infectious diseases. Understanding MRC2's interactions at the molecular level will ultimately contribute to the broader field of immunology and the development of new biopharmaceuticals, positioning MRC2 as a promising candidate for future therapeutic interventions.
