Analytical Data
-
Gene name
FAM76A
- Application
-
Alternative Names
FA76A_HUMAN; Fam76a; Family with sequence similarity 76; member A; FLJ41946; Hypothetical protein LOC230789; MGC11672; MGC34648; OTTMUSP00000010729; Protein FAM76A; RGD1305162; RP23-464L12.5; RP3-426I6.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAV0
-
Expression Region
1-307aa
-
AA Sequence
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP
-
Molecular Weight
61.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM76A, a member of the family of proteins associated with cellular signaling and stress responses, has garnered attention for its potential role in various physiological and pathological processes. Research indicates that FAM76A may be involved in pathways related to cell proliferation, differentiation, and apoptosis, making it a candidate for studies in cancer biology and other diseases. Its expression patterns suggest involvement in various tissues, hinting at a broader regulatory function within the cell. Moreover, the protein's structural characteristics and interaction with other molecular partners warrant further investigation to elucidate its precise biological functions. The recombinant production of FAM76A allows for detailed studies of its biochemical properties and functional roles. By expressing and purifying FAM76A, researchers aim to explore its molecular mechanisms and potential as a therapeutic target, particularly in conditions where its expression is dysregulated. Understanding FAM76A's function at a molecular level could provide insights into its involvement in disease processes and ultimately contribute to the development of novel diagnostic or therapeutic strategies.
