Analytical Data
-
Gene name
ZNF492
- Application
-
Alternative Names
ZNF492; KIAA1473; ZNF115; Zinc finger Protein 492; Zinc finger Protein 115
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P255
-
Expression Region
1-531 aa
-
AA Sequence
MLENYRNLVFVGIAASKPDLITCLEQGKEPWNVKRHEMVAEPPVVCSYFARDLWPKQGKKNYFQKVILRRYKKCGCENLQLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQCDKYVKVFHKFSNSNRHTIRHTGKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNETSNLSTHKRIHTGKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHAGEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKPYKCEECGKAFNQSSTLSKHKVIHTGEKPYKYEECGKAFNQSSHLTTHKMIHTGEKPYKCEECGKAFNNSSILNRHKMIHTGEKLYKPESCNNACDNIAKISKYKRNCAGEK
-
Molecular Weight
84.81 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF492 (Zinc Finger Protein 492) is a member of the zinc finger protein family, which involves a variety of roles in transcription regulation, cellular signaling, and developmental processes. Recent studies have suggested that ZNF492 may be implicated in various biological functions, including cell proliferation, differentiation, and apoptosis, which are crucial for maintaining normal physiological processes. Its expression has been associated with specific developmental stages, and alterations in ZNF492 levels have been linked to various pathological conditions, including cancers and genetic disorders. The focus on recombinant ZNF492 protein stems from the need to elucidate its biological functions and regulatory mechanisms at a molecular level. By producing recombinant ZNF492, researchers can investigate its interactions with other proteins, identify target genes, and characterize its role in gene expression regulation. Furthermore, understanding the structure and function of ZNF492 may provide insights into its potential as a therapeutic target or biomarker for disease. Thus, the study of recombinant ZNF492 protein is crucial for advancing our knowledge of its biological significance and potential applications in medicine.
