Analytical Data
-
Gene name
ZNF486
- Application
-
Alternative Names
ZNF486; KRBO2; Zinc finger Protein 486; KRAB domain only Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96H40
-
Expression Region
1-216 aa
-
AA Sequence
MESLQFRDVAVEFSLEEWHCLDTAQQNLYRDVMLENYRHLVFLGIIVSKPDLITCLEQGIKPLTMKRHEMIAKPPVVCSHFAQDLWPEQSIKDSYQKVILRKFEKCGHGNLHFKKGCESVDECKLHKRGYNGLNQCLTTTQSKIFQCGKYVKVFHQFSNSKRHKRRHTEKKPLKYIEGDKAFNQSSTHTTHKKIDTGEKPYKCEECGKAFNRSSCL
-
Molecular Weight
51.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF486, a member of the zinc finger protein family, has garnered increasing attention in recent years due to its potential roles in gene regulation and cellular processes. Researchers have identified that ZNF486 may be implicated in various biological functions, including transcriptional regulation, DNA binding, and chromatin remodeling. Its expression patterns suggest a significant involvement in developmental processes and disease states, particularly in cancer. Given the critical functions of zinc finger proteins in gene expression modulation, the recombinant production of ZNF486 has become a focus of study to better understand its structure-function relationships and regulatory mechanisms. The recombinant protein enables researchers to explore its biochemical properties, interactome, and downstream effects in cellular contexts. This research is vital for elucidating the pathways influenced by ZNF486 and its potential as a therapeutic target. By producing and characterizing ZNF486, scientists aim to lay the groundwork for future studies that could reveal novel insights into its contributions to health and disease, paving the way for potential applications in targeted therapies.
