Analytical Data
-
Gene name
FAM71C
- Application
-
Alternative Names
FAM71CProtein FAM71C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NEG0
-
Expression Region
1-241aa
-
AA Sequence
MEDCCMLPYYTAQSSPAMGMFNTSMGKLQRQLYKGEYTIFRYAPMFESDFIQISKRGEVIDVHNRARMVTMGIVRTSPCLTLPDVMLLARPAAVCDNARCGPATQKRESPPAEILELTRLLPLMFVKITIHNSVKKQLHLKLATGRSFYLQLCPPSDASEDLFVHWENLVYILRPPVEAYSDTRAILAGNTLDSSVLEEVQRSPVGYAMKFCEEKEQFRISRLHMNAEMFGSTYCDYTIEI
-
Molecular Weight
53.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM71C, a member of the FAM71 protein family, has garnered attention in recent years due to its potential roles in cellular processes, including cell signaling and regulation of cell growth. Initial studies have indicated that FAM71C may be involved in various physiological functions and disease mechanisms, particularly in the context of cancer and neurological disorders. The protein’s expression patterns and interactions with other cellular molecules suggest a complex involvement in cellular pathways that warrant further investigation. Research utilizing recombinant FAM71C has been pivotal in dissecting its functionality, allowing scientists to study its structure, ligand interactions, and downstream effects within the cell. Recombinant proteins, such as FAM71C, provide a valuable tool for elucidating these biological roles, enabling high-throughput screening assays and targeted investigations into its mechanism of action. As knowledge about FAM71C continues to expand, it is poised to contribute significantly to our understanding of specific signaling networks, potentially uncovering new therapeutic targets for diseases characterized by dysregulated cell growth and survival. Overall, the study of FAM71C and its recombinant forms is crucial for advancing our comprehension of its biological significance and implications in health and disease.
