Analytical Data
-
Gene name
HDLBP
- Application
-
Alternative Names
HDLBP;HBP;VGL;;Vigilin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00341
-
Expression Region
1060-1268aa
-
AA Sequence
DPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR
-
Molecular Weight
30.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of HDLBP (High-Density Lipoprotein Binding Protein) recombinant proteins has gained increasing attention due to their significant role in lipid metabolism and cardiovascular health. HDLBP is known to interact with high-density lipoproteins (HDL), mediating cholesterol transport and influencing atheroprotection. Aberrations in HDL function and composition are associated with various metabolic disorders and cardiovascular diseases. Researching the recombinant forms of HDLBP allows scientists to elucidate its structure-function relationship and its mechanisms in cellular lipid regulation. Additionally, recombinant HDLBP can serve as a valuable tool in investigating the therapeutic potential of HDL in counteracting cardiovascular risk factors. The production of HDLBP in heterologous systems not only facilitates the study of its biochemical properties but also enables the development of novel strategies to modify HDL functionality for therapeutic purposes. As we continue to explore the molecular intricacies of HDL and its associated proteins, understanding the dynamics of HDLBP could lead to innovative interventions for managing dyslipidemia and promoting cardiovascular health.











