Analytical Data
-
Gene name
ZNF44
- Application
-
Alternative Names
DKFZp434F1811; DKFZp686L21136; GIOT 2; GIOT-2; GIOT2; Gonadotropin inducible transcription repressor 2; Gonadotropin-inducible ovary transcription repressor 2; KOX7; Zinc finger Protein 44; Zinc finger Protein 55; Zinc finger Protein 58; Zinc finger Protein KOX7; ZNF 44; ZNF; ZNF44; ZNF44_HUMAN; ZNF504; ZNF55; ZNF58
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15621
-
Expression Region
1-154 aa
-
AA Sequence
MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQHQNLRRNPRLSETWLQNFILIHYGHLVALSDGGLLQFSTGQGLPVTQAGVQ
-
Molecular Weight
43.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF44 (Zinc Finger Protein 44) is a member of the zinc finger protein family, which plays critical roles in various biological processes, including transcriptional regulation, DNA binding, and protein-protein interactions. Emerging evidence has indicated that ZNF44 is involved in cellular differentiation and developmental processes, as well as in the pathogenesis of multiple diseases, including cancer. The ability of ZNF44 to modulate gene expression makes it a potential target for therapeutic interventions. However, the exact mechanisms through which ZNF44 exerts its effects remain largely unknown, necessitating detailed investigations into its structural and functional properties. The production of recombinant ZNF44 protein allows researchers to study its biological functions in vitro and in vivo. This includes exploring its role in regulating gene expression, understanding its interaction with other proteins, and identifying potential post-translational modifications. By utilizing techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy, scientists can elucidate the three-dimensional structure of ZNF44, providing insights into how its structure relates to function. Additionally, the recombinant protein can be used in high-throughput screening assays to discover small molecules that may modulate ZNF44 activity, offering new avenues for therapeutic development. Overall, the study of ZNF44 through recombinant protein techniques represents a crucial step in advancing our understanding of its biological significance and therapeutic potential.
