Analytical Data
-
Gene name
FAM12A
- Application
-
Alternative Names
EDDM3A; FAM12A; HE3AEpididymal secretory protein E3-alpha; Human epididymis-specific protein 3-alpha; HE3-alpha
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14507
-
Expression Region
1-147aa
-
AA Sequence
MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM12A, a member of the FAM12 family of proteins, has garnered interest in recent years due to its potential roles in various biological processes, including cell growth, differentiation, and apoptosis. Research has indicated that FAM12A may be implicated in several diseases, particularly certain cancers, where its expression levels can be altered. The protein structure of FAM12A suggests it might interact with other cellular proteins, hinting at a role in signaling pathways crucial for maintaining cellular homeostasis. Moreover, studies have shown that the recombinant expression of FAM12A can facilitate the investigation of its biological functions and interactions, thereby providing insights into its mechanistic roles in health and disease. Understanding the structure-function relationship of FAM12A through recombinant protein studies can pave the way for the development of novel therapeutic strategies targeting its pathways, particularly in oncological contexts. As a result, research into FAM12A recombinant proteins is not only essential for elucidating its biological significance but also for exploring its potential as a biomarker or therapeutic target in cancer treatment.











