Analytical Data
-
Gene name
ZNF291
- Application
-
Alternative Names
SCAPER; KIAA1454; ZNF291; MSTP063; S phase cyclin A-associated Protein in the endoplasmic reticulum; S phase cyclin A-associated Protein in the ER; Zinc finger Protein 291
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BY12
-
Expression Region
1-292 aa
-
AA Sequence
MGLIDKLCACFLSVQGPVDENPKMAIFLQHAAGLLHAMCTLCFAVTGRSYSIFDNNRQDPTGLTAALQATDLAGVLHMLYCVLFHGTILDPSTASPKENYTQNTIQVAIQSLRFFNSFAALHLPAFQSIVGAEGLSLAFRHMASSLLGHCSQVSCESLLHEVIVCVGYFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQYFSDPRLIKVLFPSLIAACYNNHQNKIILEQEMSCVLLATFIQDLAQTPGQAENQPYQPKGKCLGSQDYLELANRFPQQAWEEARQFFLKKEKK
-
Molecular Weight
57.75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF291, a member of the zinc finger protein family, is increasingly recognized for its role in various biological processes, including transcriptional regulation, cell differentiation, and response to cellular stress. The study of ZNF291 is essential due to its potential implications in cancer biology, as abnormal expression or mutations of zinc finger proteins have been linked to oncogenesis. Recent research indicates that ZNF291 may function as a transcriptional repressor or activator, influencing gene expression patterns that are crucial for maintaining cellular homeostasis. Given its multifaceted roles, the recombinant expression of ZNF291 is pivotal for understanding its structure-function relationships and interactions with other molecular partners. By producing ZNF291 in a recombinant form, researchers can conduct functional assays, protein interaction studies, and crystallization trials, which can illuminate its mechanisms of action at the molecular level. Furthermore, utilizing recombinant ZNF291 can facilitate the exploration of its potential as a therapeutic target, particularly in diseases where its regulatory functions are disrupted. As such, the investigation of ZNF291 provides significant insights into the complex regulatory networks governing cellular function and offers promising avenues for developing targeted therapies in cancer and other diseases.
