Cat: PAX2000-12093

Recombinant Human TOMM22 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TOMM22

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TOMM22; TOM22; Mitochondrial import receptor subunit TOM22 homolog; hTom22; 1C9-2; Translocase of outer membrane 22 kDa subunit homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NS69

  • Expression Region

    1-142 aa

  • AA Sequence

    MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

  • Molecular Weight

    41.36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TOMM22, part of the translocase of the outer mitochondrial membrane (TOM) complex, plays a critical role in the import of proteins into mitochondria, facilitating the translocation of precursor proteins across the outer mitochondrial membrane. Given the essential functions of mitochondria in energy production, metabolism, and apoptosis, dysregulation of TOMM22 has been implicated in various diseases, including neurodegenerative disorders and cancer. Research has increasingly focused on the molecular mechanisms underlying TOMM22's function and its interactions with other mitochondrial proteins, as understanding these pathways can offer insights into mitochondrial dysfunction. Additionally, the study of TOMM22 recombinant proteins aims to elucidate its structure-function relationships, potentially leading to novel therapeutic strategies targeting mitochondrial diseases. Consequently, producing and characterizing TOMM22 recombinant proteins is crucial for advancing our knowledge of mitochondrial biology and developing interventions for related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US