Cat: PA1000-8337

Recombinant Human CASR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CASR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CASR;GPRC2A;PCAR1;Extracellular calcium-sensing receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P41180

  • Expression Region

    21-130aa

  • AA Sequence

    GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRW LQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI DSLNLDEFCN

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CASR (Calcium-Sensing Receptor) is a critical G-protein coupled receptor that plays a vital role in maintaining calcium homeostasis in the body. It is primarily expressed in the parathyroid glands and kidneys, where it regulates parathyroid hormone secretion and renal calcium reabsorption in response to changes in extracellular calcium levels. Abnormal CASR function is linked to various disorders, including primary hyperparathyroidism and familial hypocalciuric hypercalcemia. Researchers have increasingly focused on the recombinant expression of CASR proteins to develop a better understanding of its structure-function relationship and signaling mechanisms. The study of CASR through recombinant protein techniques enables the elucidation of binding interactions with calcium and other ligands, as well as the downstream signaling pathways involved in calcium homeostasis. Furthermore, recombinant CASR provides a valuable tool for drug discovery, allowing for high-throughput screening of potential therapeutic agents that can modulate CASR activity. This research is foundational for developing novel therapies for disorders associated with calcium dysregulation. As a result, the investigation of CASR recombinant proteins not only advances our understanding of calcium metabolism but also opens avenues for innovative treatment strategies for calcium-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US