Analytical Data
-
Gene name
FAIM2
- Application
-
Alternative Names
FAIM2; KIAA0950; LFG; LFG2; NMP35; TMBIM2; Protein lifeguard 2; Fas apoptotic inhibitory molecule 2; Neural membrane protein 35; Transmembrane BAX inhibitor motif-containing protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BWQ8
-
Expression Region
1-316aa
-
AA Sequence
MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE
-
Molecular Weight
60.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAIM2, or Fas apoptotic inhibitory molecule 2, is a member of the FAIM family that plays a crucial role in regulating apoptosis and cellular survival signaling pathways. Initially identified for its anti-apoptotic function, FAIM2 is of particular interest in the context of various diseases, including cancer and autoimmune disorders. Research has indicated that overexpression of FAIM2 can confer resistance to apoptosis in cancer cells, thereby contributing to tumorigenesis and cancer progression. Additionally, FAIM2 has been implicated in regulating immune responses, highlighting its potential as a therapeutic target for modulating immune-related conditions. Recent studies have focused on understanding the mechanisms by which FAIM2 exerts its effects, including its interactions with various signaling molecules and pathways. The development of recombinant FAIM2 protein has facilitated these investigations, allowing for detailed analysis of its structure, function, and role in disease. Furthermore, insights gained from FAIM2 research could lead to innovative therapeutic strategies aimed at enhancing apoptotic sensitivity in cancer therapy or modulating immune responses in autoimmune diseases. As the understanding of FAIM2 continues to evolve, it holds promise for the development of novel interventions that could improve patient outcomes in a range of pathological conditions.
