Analytical Data
-
Gene name
FA2H
- Application
-
Alternative Names
FA2H; FAAH; FAXDC1; Fatty acid 2-hydroxylase; Fatty acid alpha-hydroxylase; Fatty acid hydroxylase domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L5A8
-
Expression Region
1-372aa
-
AA Sequence
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ
-
Molecular Weight
69.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FA2H (Fatty Acid 2-Hydroxylase) is a key enzyme involved in the synthesis of 2-hydroxy fatty acids, which play crucial roles in various biological processes including membrane structure, signaling, and energy metabolism. The interest in FA2H has grown due to its implications in both health and disease. Defects in FA2H expression are linked to several neurological disorders, including the rare genetic disorder known as "Fatty Acid Hydroxylase Deficiency," leading to brain dysfunction and developmental issues. Research on FA2H has focused on understanding its enzymatic activity, substrate specificity, and regulatory mechanisms. Recent advances in recombinant protein technology have enabled the production and purification of functional FA2H proteins, facilitating detailed biochemical studies. This research aims to elucidate the role of FA2H in fatty acid metabolism and its potential as a therapeutic target in diseases associated with fatty acid imbalances. Moreover, structural studies of FA2H may provide insights into its catalytic mechanism and how mutations affect its function, paving the way for the development of novel drugs or interventions to correct its dysregulation in relevant pathologies.
