Cat: PA1000-8332

Recombinant Human DRD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DRD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DRD1;D(1A) dopamine receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P21728

  • Expression Region

    338-446aa

  • AA Sequence

    RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT

  • Molecular Weight

    17.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Dopamine receptor D1 (DRD1) is a critical G protein-coupled receptor (GPCR) primarily involved in mediating dopaminergic signaling pathways that influence various neurological and psychiatric functions. Its role in the central nervous system has made it a focal point for research related to neurological disorders such as schizophrenia, depression, and Parkinson's disease. The reconstitution and study of DRD1 as a recombinant protein allow researchers to elucidate its structural properties, ligand-binding affinities, and downstream signaling mechanisms. Producing DRD1 in a recombinant form often involves the use of cellular expression systems, such as bacteria, yeast, or mammalian cells, enabling scientists to obtain sufficient quantities of the protein for functional assays and biophysical characterization. The study of DRD1 not only aids in understanding its normal physiological functions but also provides insights into potential therapeutic targets for the development of pharmacological agents. Furthermore, the exploration of DRD1 interactions with various compounds can pave the way for novel drug design strategies that could lead to improved treatments for dopamine-related disorders. Advances in recombinant protein technology and techniques such as cryo-electron microscopy and X-ray crystallography have been instrumental in revealing the intricate details of DRD1 structure and function, thus enriching our understanding of its pivotal role in neurotransmission and behavior.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US