Analytical Data
-
Gene name
EXOSC9
- Application
-
Alternative Names
EXOSC9. PMSCL1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q06265
-
Expression Region
124-220aa
-
AA Sequence
DPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEKAPID
-
Molecular Weight
36.41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EXOSC9, part of the exonuclease complex involved in RNA processing, has garnered increasing attention due to its pivotal role in cellular RNA metabolism and gene regulation. This protein is a key component of the RNA exosome complex, which is responsible for the degradation of various RNA species, including defective or unneeded transcripts, thus ensuring proper gene expression and maintaining RNA homeostasis. Mutations in EXOSC9 are associated with various genetic disorders, particularly those affecting neurological development, highlighting its importance in human health. Understanding the structure and function of EXOSC9 is critical for unraveling the mechanisms underlying these diseases. The study of recombinant EXOSC9 proteins allows researchers to investigate their enzymatic activity, interactions with other RNA processing factors, and their roles in the exosome complex's function. Recent advancements in protein expression systems and purification techniques have facilitated these investigations, paving the way for potential therapeutic strategies targeting EXOSC9-related pathologies. Additionally, recombinant EXOSC9 can be utilized in biochemical assays to explore its substrate specificity and regulation, contributing valuable insights into RNA metabolism and its broader implications in cellular function and disease. Overall, the exploration of EXOSC9 through recombinant protein studies not only enhances our understanding of fundamental biological processes but also opens avenues for addressing RNA-related diseases.
