Analytical Data
-
Gene name
MRP1
- Application
-
Alternative Names
MRP1；MRP；MRP1；Multidrug resistance-associated Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33527
-
Expression Region
1248-1531aa
-
AA Sequence
VRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRN YCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESA EGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDE EVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRK TKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRV IVLDKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRP1 (Multidrug Resistance Protein 1), also known as ABCC1, is a member of the ATP-binding cassette (ABC) transporter family, which plays a vital role in cellular detoxification and multidrug resistance in cancer therapy. Its main function involves the efflux of various substrates, including chemotherapeutic agents, thereby contributing to the reduced efficacy of cancer treatments. The overexpression of MRP1 in tumor cells has been linked to poor patient outcomes due to its ability to transport a wide range of anticancer drugs out of the cells, leading to resistance. This has prompted extensive research into MRP1's structure, function, and interaction with different drugs. Developing MRP1 recombinant proteins offers significant insights into the molecular mechanisms underlying its transport activity and substrate specificity. Additionally, studying these proteins can enhance our understanding of drug resistance pathways, potentially leading to the development of new therapeutic strategies to circumvent resistance mechanisms. Understanding MRP1 not only aids in improving cancer treatment efficacy but also provides a foundational knowledge for the design of inhibitors that can specifically target MRP1, thereby restoring drug sensitivity in resistant cancer cells. Overall, research on MRP1 recombinant proteins is crucial for addressing the challenges posed by multidrug resistance in oncology, paving the way for innovative approaches to enhance the effectiveness of existing therapies.
