Analytical Data
-
Gene name
TMEM34
- Application
-
Alternative Names
Transmembrane Protein 184C. Transmembrane Protein 34
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NVA4
-
Expression Region
1-261 aa
-
AA Sequence
MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWP
-
Molecular Weight
56.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM34 (Transmembrane Protein 34) is a member of the transmembrane protein family, which plays crucial roles in various cellular processes, including cell signaling, membrane trafficking, and organelle function. Recent studies have highlighted its potential involvement in the regulation of cellular homeostasis and its implications in various diseases. The recombination and expression of TMEM34 as a protein allow for in-depth exploration of its structure-function relationships and biological roles. Understanding TMEM34 at the molecular level can provide insights into its contributions to cellular mechanisms and its potential as a therapeutic target. The study of TMEM34 recombinant proteins involves various biotechnological techniques, such as cloning, expression in suitable host systems, and subsequent purification. These approaches enable researchers to investigate the protein's functional properties, interactions with other cellular components, and effects on cellular behavior. Given its potential links to pathological conditions, including cancer and neurodegenerative disorders, TMEM34 has emerged as an important subject in molecular and cellular biology research. Establishing a comprehensive understanding of TMEM34 through recombinant protein studies may pave the way for novel diagnostic and therapeutic strategies, emphasizing its significance in both fundamental research and clinical applications.
