Analytical Data
-
Gene name
ZNF187
- Application
-
Alternative Names
MGC2815; Protein SRE ZBP; Protein SRE-ZBP; SRE ZBP; Zinc finger and SCAN domain containing Protein 26; Zinc finger and SCAN domain-containing Protein 26; Zinc finger Protein 187; ZN187_HUMAN; Znf187; ZSCAN26
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16670
-
Expression Region
316-586 aa
-
AA Sequence
QRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGEKPFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECGKAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFIRSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQH
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF187 (Zinc Finger Protein 187) is a member of the zinc finger protein family, which is known for its role in DNA binding and gene regulation. Research into ZNF187 has gained interest due to its potential involvement in various biological processes, including cellular differentiation, development, and the modulation of the immune response. Recent studies have indicated that ZNF187 may play a role in the pathogenesis of certain diseases, including cancer, by influencing gene expression patterns that are crucial for cell growth and survival. Additionally, the unique structural features of ZNF187, characterized by its zinc finger motifs, make it an attractive target for protein-protein interaction studies and therapeutic applications. The production of recombinant ZNF187 protein allows researchers to investigate its biochemical properties, function, and potential interactions with other molecules in vitro. Understanding the mechanisms by which ZNF187 exerts its effects can contribute to the identification of new biomarkers and therapeutic targets, paving the way for innovative approaches in the treatment of diseases linked to aberrant gene regulation. Thus, the study of recombinant ZNF187 protein is essential for uncovering its biological significance and therapeutic potential.
