Analytical Data
-
Gene name
TMEM26
- Application
-
Alternative Names
DKFZp686D09128; MGC35010; TMEM26; TMM26_HUMAN; Transmembrane Protein 26
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZUK4
-
Expression Region
1-223 aa
-
AA Sequence
MEGLVFLNALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIFLYLISIVPSLWLLELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTSRADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIGGGITRDQLSQLLLMFVGTAADILEFTSETLEEQNVRLCWKNSTNRRHTNPKWQLVLF
-
Molecular Weight
52.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM26, or Transmembrane Protein 26, is an integral membrane protein that has garnered interest in recent years due to its potential roles in various biological processes and disease mechanisms. Initially identified as a gene associated with cancer and metabolic disorders, studies have suggested that TMEM26 may play a critical role in cellular pathways, including those related to inflammation, cell proliferation, and apoptosis. The protein is thought to be involved in the regulation of cellular stress responses, making it a potential target for therapeutic interventions. Its expression is notable in several tissue types, and aberrations in TMEM26 levels have been linked to pathological conditions, including tumors and neurodegenerative diseases. Given these associations, researchers have focused on characterizing TMEM26 through recombinant protein expression, which allows for detailed functional studies and structural analysis. This research aims to elucidate the mechanistic roles of TMEM26 in normal physiology and disease states, providing insights that may lead to novel therapeutic strategies targeting this protein. Understanding the structure and function of TMEM26 could pave the way for advancements in treatment options for cancer and other TMEM26-related disorders. As such, the study of TMEM26 is not only fundamental for basic biological research but also has significant clinical implications.
