Analytical Data
-
Gene name
ARSB
- Application
-
Alternative Names
ARSB；Arylsulfatase B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15848
-
Expression Region
37-533aa
-
AA Sequence
SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
-
Molecular Weight
62.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ARSB (Arylsulfatase B) recombinant proteins is rooted in the pursuit of understanding lysosomal storage disorders, particularly metachromatic leukodystrophy (MLD), which is associated with ARSB gene mutations. ARSB is a sulfatase enzyme responsible for the hydrolysis of sulfate esters, playing a crucial role in the metabolism of sulfatides in the lysosome. Deficiencies in ARSB lead to the accumulation of toxic substances, resulting in progressive neurological degeneration and impaired myelin formation. Research on ARSB recombinant proteins aims to develop therapeutic strategies, including enzyme replacement therapy, to restore ARSB activity in affected individuals. Advances in recombinant DNA technology and protein engineering have facilitated the production of functional ARSB proteins in various expression systems. These efforts not only enhance our understanding of the enzyme's structure-function relationship but also provide essential tools for investigating the pathophysiology of MLD. Furthermore, studies on ARSB recombinant proteins contribute to the development of novel diagnostic techniques and biomarker identification, potentially paving the way for earlier detection and intervention in lysosomal storage disorders. As a result, the ongoing research endeavors focused on ARSB recombinant proteins represent a promising avenue towards effective treatments for genetic diseases resulting from enzyme deficiencies.
