Analytical Data
-
Gene name
TMEM189
- Application
-
Alternative Names
Plasmanylethanolamine desaturase 1. EC:1.14.19.77. Transmembrane Protein 189
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A5PLL7
-
Expression Region
1-270 aa
-
AA Sequence
MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK
-
Molecular Weight
57.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM189 is a member of the Transmembrane Protein 189 family, which has garnered attention due to its potential role in various biological processes, including cellular signaling, membrane dynamics, and disease mechanisms. Recent research indicates that TMEM189 may be implicated in the regulation of immune responses and inflammatory pathways. Its expression patterns have been linked to specific cancers and neurodegenerative disorders, suggesting that understanding its function could have significant implications for therapeutic development. Moreover, the study of TMEM189 recombinant proteins enables researchers to investigate its structure and interactions at a molecular level, facilitating insights into its biological significance. The generation of recombinant TMEM189 proteins also provides a valuable tool for examining its role in cellular contexts and may aid in identifying potential binding partners or pathways affected by this protein. Continued exploration of TMEM189 through recombinant protein studies is essential for elucidating its physiological roles and could contribute to the identification of novel biomarkers or targets for clinical intervention in diseases associated with dysregulated TMEM189 expression.
