Analytical Data
-
Gene name
TMEM191A
- Application
-
Alternative Names
TMEM191A; Transmembrane Protein 191A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0A3
-
Expression Region
1-160 aa
-
AA Sequence
MMNNTDFLMLNNPWNKLCLVSMDFCFPLDFVSNLFWIFASKFIIVTGQIKADFKRTSWEAKAEGSLEPGRLKLQLASIVPLYSSLVTAGPASKIIILKRTSLPTVSPSNERAYLLPVSFTDLAHVFYLSYFSINAKSNSFSLDIIIALGIPHNTQAHFNH
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM191A, a member of the transmembrane protein family, has garnered attention for its potential role in cellular processes and disease mechanisms. Recent studies have indicated that TMEM191A is involved in various biological functions, including cellular signaling and membrane dynamics. Its expression patterns suggest a possible involvement in neurodevelopment and neurodegenerative disorders. The interest in recombinant TMEM191A protein arises from its potential as a biomarker or therapeutic target, especially since its dysregulation has been associated with specific pathologies. Understanding the structure and function of this protein through recombinant methods can provide insights into its role in health and disease. Moreover, the production of TMEM191A as a recombinant protein enables detailed biochemical and biophysical analyses, facilitating the exploration of its interaction with other cellular components. Consequently, studying recombinant TMEM191A may uncover novel mechanisms underlying its function and lay the groundwork for future therapeutic strategies targeting related diseases.











