Cat: PAX2000-12027

Recombinant Human TMEM191A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMEM191A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMEM191A; Transmembrane Protein 191A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H0A3

  • Expression Region

    1-160 aa

  • AA Sequence

    MMNNTDFLMLNNPWNKLCLVSMDFCFPLDFVSNLFWIFASKFIIVTGQIKADFKRTSWEAKAEGSLEPGRLKLQLASIVPLYSSLVTAGPASKIIILKRTSLPTVSPSNERAYLLPVSFTDLAHVFYLSYFSINAKSNSFSLDIIIALGIPHNTQAHFNH

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMEM191A, a member of the transmembrane protein family, has garnered attention for its potential role in cellular processes and disease mechanisms. Recent studies have indicated that TMEM191A is involved in various biological functions, including cellular signaling and membrane dynamics. Its expression patterns suggest a possible involvement in neurodevelopment and neurodegenerative disorders. The interest in recombinant TMEM191A protein arises from its potential as a biomarker or therapeutic target, especially since its dysregulation has been associated with specific pathologies. Understanding the structure and function of this protein through recombinant methods can provide insights into its role in health and disease. Moreover, the production of TMEM191A as a recombinant protein enables detailed biochemical and biophysical analyses, facilitating the exploration of its interaction with other cellular components. Consequently, studying recombinant TMEM191A may uncover novel mechanisms underlying its function and lay the groundwork for future therapeutic strategies targeting related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US