Analytical Data
-
Gene name
ERC1
- Application
-
Alternative Names
Cast 2; CAST2; CAZ associated structural protein 2; Elks; ELKS/RAB6 interacting/CAST family member 1; ELKS/RAB6-interacting/CAST family member 1; ERC 1; ERC protein 1 ; ERC-1; Erc1; ERC1 protein; KIAA1081
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IUD2
-
Expression Region
1-91aa
-
AA Sequence
MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS
-
Molecular Weight
36.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ERC1, or Elongator Protein Complex 1, is a pivotal component of the Elongator complex, which plays a crucial role in mRNA transcription elongation and chromatin remodeling. The significance of ERC1 has garnered attention in various research fields, particularly due to its involvement in cellular processes such as gene expression regulation, RNA modification, and even in pathways associated with neurodegenerative diseases. Recent studies have suggested that ERC1 may influence the translation of specific mRNAs, thereby impacting protein synthesis and cellular function. Furthermore, mutations in genes encoding components of the Elongator complex have been linked to several genetic disorders, including intellectual disability and developmental issues. The investigation of ERC1, particularly through the lens of recombinant protein technologies, allows researchers to dissect its molecular mechanisms and interactions within the cell. By producing recombinant ERC1 protein, scientists can explore its functional roles and potential implications in health and disease, making it a focal point for understanding the complexities of gene regulation and its downstream effects on organismal biology. This research not only enhances our fundamental understanding of transcriptional regulation but also opens avenues for therapeutic interventions targeting associated genetic and neurological disorders. The ongoing studies into ERC1's structure and function aim to elucidate its role in cellular physiology and pathology, contributing to the broader knowledge of gene expression control mechanisms in eukaryotic cells.











