Analytical Data
-
Gene name
TMEM179B
- Application
-
Alternative Names
TMEM179B; Transmembrane Protein 179B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z7N9
-
Expression Region
1-219 aa
-
AA Sequence
MALSWLQRVELALFAAAFLCGAVAAAAMTRTQGSFSGRCPLYGVATLNGSSLALSRPSAPSLCYFVAGASGLLALYCLLLLLFWIYSSCIEDSHRGAIGLRIALAISAIAVFLVLVSACILRFGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSSWVNLVLWCVVLVLQVVQWKSEATPYRPLERGDPEWSSETDALVGSRLSHS
-
Molecular Weight
50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM179B, a member of the transmembrane protein family, has garnered significant attention due to its potential role in various biological processes, including cell signaling and membrane trafficking. Recent studies suggest that TMEM179B may be implicated in neurodevelopmental disorders, making it a candidate for research in neurological diseases. Its expression patterns in different tissues and its involvement in cellular mechanisms underscore the need for generating recombinant TMEM179B protein for further functional studies. Developing this protein allows researchers to investigate its structure-function relationships, study its interactions with other cellular components, and assess its biological activities in vitro and in vivo. Furthermore, recombinant TMEM179B can serve as a valuable tool for drug discovery efforts aimed at modulating its activity in pathological conditions. Overall, understanding the functional role of TMEM179B through the study of its recombinant protein is crucial for elucidating its contributions to human health and disease.
