Analytical Data
-
Gene name
ERBB2IP
- Application
-
Alternative Names
Densin-180-like protein; Erbb2-interacting protein; Erbb2ip; Erbin; LAP2; LAP2_HUMAN; Protein LAP2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96RT1
-
Expression Region
1272-1371aa
-
AA Sequence
QGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ERBB2IP (Erb-B2 Receptor Tyrosine Kinase 2 Interacting Protein) is a significant molecule in the field of cancer research due to its interaction with the ErbB2 receptor, which is known to play a crucial role in the development and progression of various cancers, particularly breast cancer. Initial studies identified ERBB2IP as a binding partner of ErbB2, suggesting its involvement in signaling pathways that promote cell proliferation and survival. The overexpression of the ErbB2 receptor has been linked to aggressive tumor characteristics and poor prognosis in patients, highlighting the importance of understanding the molecular mechanisms underlying ErbB2 signaling. Recent research efforts have focused on characterizing the functional roles of ERBB2IP in modulating these pathways, including its influence on receptor localization, stabilization, and downstream signaling events. Additionally, the potential of ERBB2IP as a therapeutic target has garnered attention, with studies exploring the effects of disrupting its interactions within the ErbB2 signaling network. By generating recombinant ERBB2IP proteins, researchers aim to elucidate the structural and functional properties that govern its interactions, thereby paving the way for novel therapeutic strategies and improving the understanding of cancer biology. The study of ERBB2IP thus serves not only as a means to shed light on fundamental cancer mechanisms but also holds promise for enhancing targeted treatment approaches against ErbB2-positive malignancies.
