Analytical Data
-
Gene name
TMEM123
- Application
-
Alternative Names
TMEM123; KCT3; PSEC0111; UNQ641/PRO1271; Porimin; Keratinocytes-associated transmembrane Protein 3; KCT-3; Pro-oncosis receptor inducing membrane injury; Transmembrane Protein 123
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N131
-
Expression Region
1-208 aa
-
AA Sequence
MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII
-
Molecular Weight
47.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM123, a member of the transmembrane protein family, has garnered attention in recent years due to its potential roles in various biological processes, including cell signaling, development, and disease pathogenesis. It is predominantly expressed in the brain and has been implicated in neuronal function and maintenance. Research into TMEM123 has suggested its involvement in the regulation of cellular stress responses and lipid metabolism, making it a candidate for studying neurodegenerative diseases and metabolic disorders. The recombinant expression of TMEM123 protein allows for detailed functional studies and structural analysis, facilitating insights into its mechanisms of action. Recent advancements in recombinant protein technologies have enabled efficient production and purification of TMEM123, paving the way for investigations into its interactions with other cellular components and its role in signaling pathways. Furthermore, studying TMEM123 may lead to the identification of novel therapeutic targets, especially in conditions where its function is disrupted. Given its emerging significance in various physiological and pathological contexts, ongoing research aims to elucidate the molecular and cellular functions of TMEM123, ultimately contributing to a better understanding of its relevance in health and disease.
