Cat: PAX2000-12737

Recombinant Human ZNF138 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZNF138

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZNF138Zinc finger Protein 138

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52744

  • Expression Region

    1-262 aa

  • AA Sequence

    MKRHEMVVAKHSALCSRFAQDLWLEQNIKDSFQKVTLSRYGKYGHKNLQLRKGCKSVDEC KGHQGGFNGLNQCLKITTSKIFQCNKYVKVMHKFSNSNRHKIRHTENKHFRCKECDKSLC MLSRLTQHKKIHTRENFYKCEECGKTFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSI LTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKH QIIYTGEEPYKCEECGKAFNLS

  • Molecular Weight

    30.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZNF138, a member of the zinc finger protein family, has garnered attention in recent years due to its potential roles in various biological processes, including gene regulation, cell differentiation, and development. This transcription factor is characterized by its distinct zinc finger motifs, which allow it to bind to specific DNA sequences and modulate the expression of target genes. Recent studies have suggested that ZNF138 may play a crucial role in neurological development and could be implicated in certain diseases, including cancers and neurodegenerative disorders. Understanding its precise functions and mechanisms of action is vital for uncovering its biological significance and potential therapeutic applications. In order to investigate these roles further, researchers have focused on producing recombinant ZNF138 protein. This recombinant protein enables comprehensive biochemical analyses, including DNA binding assays, protein-protein interaction studies, and functional assays to elucidate its regulatory mechanisms. By exploring the structure and function of ZNF138, scientists aim to unravel its contributions to cellular processes and its implications in health and disease, paving the way for potential interventions that target its pathways. Overall, the study of recombinant ZNF138 protein represents a critical step toward elucidating the complex regulatory networks in which this transcription factor operates, ultimately enhancing our understanding of molecular biology and pathology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US