Analytical Data
-
Gene name
ZNF138
- Application
-
Alternative Names
ZNF138Zinc finger Protein 138
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52744
-
Expression Region
1-262 aa
-
AA Sequence
MKRHEMVVAKHSALCSRFAQDLWLEQNIKDSFQKVTLSRYGKYGHKNLQLRKGCKSVDEC KGHQGGFNGLNQCLKITTSKIFQCNKYVKVMHKFSNSNRHKIRHTENKHFRCKECDKSLC MLSRLTQHKKIHTRENFYKCEECGKTFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSI LTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKH QIIYTGEEPYKCEECGKAFNLS
-
Molecular Weight
30.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF138, a member of the zinc finger protein family, has garnered attention in recent years due to its potential roles in various biological processes, including gene regulation, cell differentiation, and development. This transcription factor is characterized by its distinct zinc finger motifs, which allow it to bind to specific DNA sequences and modulate the expression of target genes. Recent studies have suggested that ZNF138 may play a crucial role in neurological development and could be implicated in certain diseases, including cancers and neurodegenerative disorders. Understanding its precise functions and mechanisms of action is vital for uncovering its biological significance and potential therapeutic applications. In order to investigate these roles further, researchers have focused on producing recombinant ZNF138 protein. This recombinant protein enables comprehensive biochemical analyses, including DNA binding assays, protein-protein interaction studies, and functional assays to elucidate its regulatory mechanisms. By exploring the structure and function of ZNF138, scientists aim to unravel its contributions to cellular processes and its implications in health and disease, paving the way for potential interventions that target its pathways. Overall, the study of recombinant ZNF138 protein represents a critical step toward elucidating the complex regulatory networks in which this transcription factor operates, ultimately enhancing our understanding of molecular biology and pathology.
