Analytical Data
-
Gene name
PRG4
- Application
-
Alternative Names
PRG4；MSF；SZP；Proteoglycan 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92954
-
Expression Region
25-156aa
-
AA Sequence
QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE
-
Molecular Weight
16.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRG4 (Proteoglycan 4), also known as lubricin, is a glycoprotein predominantly expressed in synovial fluid and on the surfaces of articular cartilage, playing a critical role in joint lubrication and the maintenance of cartilage integrity. Research into PRG4 has gained significant attention due to its potential implications in osteoarthritis and other joint diseases, where its protective and lubricating functions may be compromised. The development of recombinant PRG4 proteins has emerged as a promising therapeutic strategy to restore lubrication in joints, offering a means to alleviate pain and improve mobility in affected individuals. Moreover, understanding the molecular mechanisms underlying PRG4 expression and function can provide insights into cartilage biology and the pathophysiology of degenerative joint diseases. Recent studies have also explored the biophysical properties of PRG4, highlighting its ability to reduce friction and wear in joint environments, thereby suggesting its utility in tissue engineering and regenerative medicine. This growing body of research positions PRG4 not only as a critical molecule in joint health but also as a potential biomarker for assessing cartilage degeneration and as a target for innovative therapeutic approaches aimed at joint preservation and repair. With ongoing advancements in recombinant protein technology, the harnessing of PRG4 could lead to significant breakthroughs in both clinical applications and fundamental research in joint biology.
