Cat: PA1000-8261

Recombinant Human PRG4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PRG4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PRG4;MSF;SZP;Proteoglycan 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92954

  • Expression Region

    25-156aa

  • AA Sequence

    QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE

  • Molecular Weight

    16.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PRG4 (Proteoglycan 4), also known as lubricin, is a glycoprotein predominantly expressed in synovial fluid and on the surfaces of articular cartilage, playing a critical role in joint lubrication and the maintenance of cartilage integrity. Research into PRG4 has gained significant attention due to its potential implications in osteoarthritis and other joint diseases, where its protective and lubricating functions may be compromised. The development of recombinant PRG4 proteins has emerged as a promising therapeutic strategy to restore lubrication in joints, offering a means to alleviate pain and improve mobility in affected individuals. Moreover, understanding the molecular mechanisms underlying PRG4 expression and function can provide insights into cartilage biology and the pathophysiology of degenerative joint diseases. Recent studies have also explored the biophysical properties of PRG4, highlighting its ability to reduce friction and wear in joint environments, thereby suggesting its utility in tissue engineering and regenerative medicine. This growing body of research positions PRG4 not only as a critical molecule in joint health but also as a potential biomarker for assessing cartilage degeneration and as a target for innovative therapeutic approaches aimed at joint preservation and repair. With ongoing advancements in recombinant protein technology, the harnessing of PRG4 could lead to significant breakthroughs in both clinical applications and fundamental research in joint biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US