Analytical Data
-
Gene name
ENTPD5
- Application
-
Alternative Names
ENTPD5; CD39L4; PCPH; Ectonucleoside triphosphate diphosphohydrolase 5; NTPDase 5; CD39 antigen-like 4; ER-UDPase; Guanosine-diphosphatase ENTPD5; GDPase ENTPD5; Nucleoside diphosphatase; Uridine-diphosphatase ENTPD5; UDPase ENTPD5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75356
-
Expression Region
1-407aa
-
AA Sequence
MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQHIISWVN
-
Molecular Weight
70.18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ENTPD5 (ectonucleotide triphosphate diphosphohydrolase 5) is an enzyme that plays a crucial role in the hydrolysis of nucleoside triphosphates (NTPs) and the regulation of extracellular nucleotide signaling. Its study has gained significance due to its involvement in various physiological and pathological processes, including cell proliferation, apoptosis, and immune responses. Recent research indicates that ENTPD5 may also be implicated in cancer progression and metabolism, making it a potential therapeutic target. The recombinant expression of ENTPD5 allows for detailed investigations into its enzymatic activity, structure-function relationships, and interactions with other biomolecules. This research not only enhances our understanding of the enzyme's biological roles but also contributes to the development of novel strategies for treating diseases associated with dysfunctional nucleotide signaling. By elucidating the molecular mechanisms governing ENTPD5 activity, scientists aim to uncover new insights into cellular regulation and therapeutic interventions for various conditions, further highlighting ENTPD5's importance in both basic and translational research.
