Cat: PA1000-8245

Recombinant Human PSME3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSME3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSME3;Proteasome activator complex subunit 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P61289

  • Expression Region

    1-254aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMASLLKVDQEVKLKVDSFRERITSEAEDLV ANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLD GPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLI EKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVT LHDMILKNIEKIKRPRSSNAETLY

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The PSME3 protein, a member of the proteasome activator complex, plays a crucial role in regulating protein degradation by enhancing the activity of the 20S core proteasome. The process of protein degradation is vital for maintaining cellular homeostasis, regulating the cell cycle, and responding to stress. Abnormalities in proteasomal function can lead to various diseases, including cancer and neurodegenerative disorders. Recent research has highlighted the significance of PSME3 in modulating immune responses, particularly in the context of antigen processing and presentation. Studies have shown that PSME3 is involved in the degradation of polyubiquitinated proteins, thus ensuring the proper turnover of regulatory factors that influence cell survival and apoptosis. Additionally, PSME3 has been implicated in the response to viral infections, where it may enhance the degradation of viral proteins, contributing to host defense mechanisms. Given its central role in these processes, PSME3 has emerged as an important target for therapeutic interventions. Investigating the structural and functional characteristics of PSME3 and its interactions with other proteasomal components may provide insights into its precise mechanisms of action and potential roles in disease pathology. Understanding the dynamics of PSME3 could lead to the development of novel strategies aimed at modulating proteasomal activity to treat diseases associated with its dysfunction. Consequently, ongoing research into PSME3 recombinant proteins is essential for elucidating its biological functions and exploring its potential as a biomarker or therapeutic target in various clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US