Analytical Data
-
Gene name
TM2D3
- Application
-
Alternative Names
TM2D3; BLP2; TM2 domain-containing Protein 3; Beta-amyloid-binding Protein-like Protein 2; BBP-like Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRN9
-
Expression Region
1-221 aa
-
AA Sequence
MAGGVRPLRGLRALCRVLLFLSQFCILSGGESTEIPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSCPRQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI
-
Molecular Weight
50.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TM2D3, a member of the transmembrane protein family, has garnered attention in recent years due to its potential role in various physiological and pathological processes. This protein is primarily expressed in the brain and is thought to be involved in cellular signaling pathways, neuronal development, and synaptic function. Research indicates that TM2D3 may play a critical role in neurodegenerative diseases and other neurological disorders, making it a target of interest for therapeutic interventions. Its unique transmembrane structure allows it to interact with a variety of cellular components, thereby influencing numerous biological functions. Despite the growing interest, the specific mechanisms by which TM2D3 exerts its effects remain poorly understood. Consequently, the production of recombinant TM2D3 has become essential for elucidating its biological roles and interactions. By generating and characterizing recombinant TM2D3, researchers aim to gain insights into its structural properties, functional significance, and potential as a biomarker or therapeutic target. Understanding the biology of TM2D3 could lead to new strategies for diagnosing and treating conditions associated with its dysfunction, thereby addressing a critical gap in current biomedical research.
