Analytical Data
-
Gene name
ZMAT4
- Application
-
Alternative Names
Zinc finger matrin type 4; Zinc finger matrin-type Protein 4; Zmat4; ZMAT4_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H898
-
Expression Region
1-153 aa
-
AA Sequence
MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK
-
Molecular Weight
42.57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZMAT4 (Zinc Finger Matriptase-4) is a protein that has garnered attention in the fields of molecular biology and biomedical research due to its potential roles in various physiological and pathological processes. Research has indicated that ZMAT4 may be involved in cellular signaling pathways, gene expression regulation, and cellular responses to stress, suggesting its importance in normal cellular functions as well as in disease states. Studies have shown that alterations in ZMAT4 expression levels are associated with certain cancers and other pathological conditions, prompting investigations into its mechanism of action and potential as a therapeutic target. The protein contains zinc finger motifs, which are often implicated in DNA binding and interaction with other proteins, underscoring its likely role in transcriptional regulation. As such, recombinant ZMAT4 proteins have been produced for further studies to elucidate their structure-function relationships and interactions with other cellular components. Understanding the functional mechanisms of ZMAT4 may reveal new insights into its contributions to disease mechanisms and pave the way for novel therapeutic strategies targeting its pathways. Given the rising interest in targeted therapies, ZMAT4 research has significant implications not only in cancer biology but also in regenerative medicine and the development of biomolecular tools for therapeutic applications.
