Analytical Data
-
Gene name
ZIK1
- Application
-
Alternative Names
ZIK1; ZNF762Zinc finger Protein interacting with ribonucleoProtein K; Zinc finger Protein 762
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3SY52
-
Expression Region
1-384 aa
-
AA Sequence
MCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSKCGKAFRGKYSLVQHQRVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSFSQSAILNQHRRIHTGAKPYECGQCGKSFSQKATLIKHQRVHTGERPYKCGDCGKSFSQSSILIQHRRIHTGARPYECGQCGKSFSQKSGLIQHQVVHTGERPYECNKCGNSFSQCSSLIHHQKCHNT
-
Molecular Weight
70.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZIK1 recombinant protein has garnered significant attention in recent years due to its potential implications in understanding and combating Zika virus infections, which have emerged as a global public health concern. Zika virus, primarily transmitted by Aedes mosquitoes, is linked to severe neurological complications, including microcephaly in newborns and Guillain-Barré syndrome in adults. The development of ZIK1 recombinant protein is pivotal for various research applications, including vaccine development, diagnostic assays, and therapeutic interventions. By expressing and purifying ZIK1, researchers can explore its structural and functional properties, facilitating the design of targeted strategies to inhibit viral entry and replication. Furthermore, studying ZIK1 in the context of immune responses aids in identifying potential immunogenic epitopes, which are critical for informing vaccine design. Given the lack of specific antiviral treatments for Zika virus and increasing incidences worldwide, the establishment of robust research tools, such as ZIK1 recombinant protein, is essential for advancing our understanding of the virus and developing effective countermeasures against future outbreaks.
