Analytical Data
-
Gene name
DEXI
- Application
-
Alternative Names
DEXI;MYLE;Dexamethasone-induced Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95424
-
Expression Region
1-95aa
-
AA Sequence
MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
-
Molecular Weight
10.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DEXI (DEXDc1) is an essential protein in various cellular processes and is particularly significant in the study of immune responses and cellular signaling. Recent research has highlighted its role in regulating protein interactions and post-translational modifications, which are crucial for maintaining cellular homeostasis and responding to stress conditions. The importance of DEXI in the immune system has prompted investigations into its function and structure, revealing its potential involvement in the modulation of inflammatory responses. Furthermore, DEXI's reorganization within the cellular environment during various stimuli has garnered attention in the context of disease mechanisms, including autoimmune disorders and cancer. Understanding the structural dynamics and functional capabilities of DEXI can provide insights into its regulatory mechanisms, ultimately contributing to the development of therapeutic strategies targeting related pathways. This research not only underscores the biological relevance of DEXI but also emphasizes the necessity of advanced methods to elucidate its complex interactions within the cell.











