Analytical Data
-
Gene name
ZFPL1
- Application
-
Alternative Names
ZFPL1; Zinc finger Protein-like 1; Zinc finger Protein MCG4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95159
-
Expression Region
1-310 aa
-
AA Sequence
MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS
-
Molecular Weight
60.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZFPL1, or Zinc Finger Protein like 1, is a member of the zinc finger protein family, which plays significant roles in various biological processes, including transcription regulation, cell differentiation, and proliferation. Recent studies have highlighted the potential importance of ZFPL1 in development and disease, especially in the context of cancer, where it may influence tumorigenesis through the regulation of gene expression related to cell cycle and apoptosis. The recombinant expression of ZFPL1 has garnered interest as a tool for understanding its functional mechanisms at the molecular level. By producing ZFPL1 as a recombinant protein, researchers aim to investigate its structural properties, binding interactions, and specific target genes. Moreover, exploring the protein's role in essential cellular pathways can provide insights into its potential as a therapeutic target. Advances in biotechnological methods have enabled the efficient production and purification of ZFPL1, facilitating experimental studies. By delving into the function of ZFPL1, we can glean more about its contributions to cellular homeostasis and its implications in pathophysiological conditions, paving the way for novel strategies in disease management and treatment.
