Analytical Data
-
Gene name
AATK
- Application
-
Alternative Names
AATK；AATYK；KIAA0641；LMR1；Serine/threonine-Protein kinase LMTK1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q80YE4
-
Expression Region
8-411aa
-
AA Sequence
PSFAFSSHFDPDGAPLSELSWSSSLAVVAVSFSGIFTVVILMLACLCCKKGGIGFKEFENAEGDEYVADFSEQGSPAAAAQTGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDLGRHSLLYLKEIGHGWFGKVFLGEVHSGVSGTQVVVKELKVSASVQEQMQFLEEAQPYRALQHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVTESMAPDPLTLQRMACEVACGVLHLHRHNYVHSDLALRNCLLTADLTVKVGDYGLSHCKYREDYLVTADQLWVPLRWIAPELVDEVHGNLLVVDQTKSSNVWSLGVTIWELFELGAQPYPQHSDRQVLAYAVREQQLKLPKPQLQLALSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGTTELEEEF
-
Molecular Weight
71 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AATK (Alpha-1 Antitrypsin Knockout) recombinant proteins have garnered significant attention in biomedical research due to their potential implications in understanding various diseases and therapeutic applications. Alpha-1 Antitrypsin (AAT) is a crucial protein that inhibits proteolytic enzymes, particularly neutrophil elastase, thereby playing a vital role in protecting tissues from damage caused by inflammation and oxidative stress. Mutations or deficiencies in the AAT gene can lead to severe lung and liver diseases, including emphysema and cirrhosis. The use of AATK recombinant proteins allows researchers to create models that simulate AAT deficiencies, facilitating the investigation of the underlying mechanisms of these diseases. Furthermore, these recombinant proteins can aid in the development of novel therapeutic strategies aimed at replenishing AAT levels or inhibiting its degradation. By examining the structural and functional properties of AATK, scientists can identify potential drug targets and improve our understanding of AAT's role in chronic inflammatory conditions. Overall, the study of AATK recombinant proteins represents a promising avenue for advancing both basic and translational research in pathologies associated with AAT deficiency.
