Analytical Data
-
Gene name
ELMOD2
- Application
-
Alternative Names
9830169G11Rik; ELMD2_HUMAN; ELMO domain containing 2; ELMO domain containing protein 2; ELMO domain-containing protein 2; ELMO/CED 12 domain containing 2; ELMOD2; MGC10084
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZ81
-
Expression Region
1-293aa
-
AA Sequence
MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMPTKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGTNLTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKGLLLDRNVALTLKV
-
Molecular Weight
57.97 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ELOVL2 (elongation of very long-chain fatty acids 2) is a critical enzyme involved in the biosynthesis of very long-chain fatty acids (VLCFAs), which play essential roles in cellular processes, including membrane structure and signaling. VLCFAs are vital for the function and integrity of various tissues, particularly in the brain and skin. The significance of ELOVL2 became increasingly evident with the discovery that defects in its gene can lead to severe neurological disorders and skin abnormalities, underscoring its role in fatty acid metabolism. Given the connection between ELOVL2 and diseases such as X-linked adrenoleukodystrophy and certain forms of retinitis pigmentosa, researchers have focused on characterizing ELOVL2's enzymatic activity, substrate specificity, and regulatory mechanisms. The recombinant expression of ELOVL2 protein in various systems has facilitated the study of its functions and interactions, potentially paving the way for therapeutic strategies aimed at rectifying VLCFA synthesis disorders. Understanding the molecular basis of ELOVL2 activity may also contribute to the development of targeted interventions in associated diseases, making it a key protein of interest in metabolic and neurodegenerative research. The ongoing investigation into ELOVL2 and its recombinant form not only sheds light on fundamental biological processes but also holds promise for advancing treatment options for conditions linked to lipid metabolism dysregulation.
