Analytical Data
-
Gene name
PAWP
- Application
-
Alternative Names
PAWP；PAWP；Postacrosomal sheath WW domain-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ICG8
-
Expression Region
1-309aa
-
AA Sequence
MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPQESTAAQAPENEASLPSASSSQVHS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PAWP (paternal asthenozoospermia-associated protein) is a protein that has gained attention in reproductive biology, particularly in studies related to male infertility. Identified as a key factor in sperm function and early embryonic development, PAWP plays a critical role in the fertilization process by facilitating sperm-egg interactions and ensuring proper zygote formation. Research indicates that mutations or alterations in the PAWP gene may be linked to conditions such as asthenozoospermia, where sperm motility is impaired, contributing to male infertility. Previous studies have explored the localization and expression patterns of PAWP in various species, providing insights into its evolutionary conservation and functional significance. Furthermore, investigations into the protein's structural characteristics and interaction with other cellular components have emphasized its potential as a biomarker for reproductive health. Given the rising prevalence of infertility issues in modern society, understanding the role of PAWP and its implications in reproductive mechanisms is vital for developing targeted therapies and diagnostic tools. This research also opens avenues for investigating the broader implications of PAWP in embryonic development, potentially informing future assisted reproductive technologies and enhancing our understanding of sperm biology. Overall, PAWP represents a promising candidate for advancing knowledge in reproductive health and addressing infertility challenges, marking it as a focal point for ongoing and future scientific exploration.
