Analytical Data
-
Gene name
CHRM2
- Application
-
Alternative Names
CHRM2；Muscarinic acetylcholine receptor M2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08172
-
Expression Region
210-387aa
-
AA Sequence
SRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTR
-
Molecular Weight
23.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHRM2, a gene encoding the muscarinic acetylcholine receptor M2, plays a crucial role in various physiological processes, including modulation of neurotransmitter release and regulation of cardiovascular functions. Research has shown that CHRM2 is involved in cognitive functions and has been associated with several neuropsychiatric disorders, such as schizophrenia and Alzheimer's disease. The receptor's activation influences intracellular signaling pathways, making it a target for potential therapeutic interventions. The study of recombinant CHRM2 protein is essential for understanding the receptor's structure-function relationship and developing drugs that can selectively modulate its activity. By producing recombinant CHRM2 in various expression systems, researchers aim to investigate its pharmacological properties and interactions with ligands. This research not only contributes to basic science but also has implications for designing novel treatments for diseases linked to CHRM2 dysregulation. Furthermore, the successful characterization and manipulation of this protein may open up avenues for advanced therapeutic strategies in the field of neurology and psychiatry.
