Cat: PA1000-8199

Recombinant Human TERF2IP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TERF2IP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TERF2IP;KARS;KIAA0070;Lysine--tRNA ligase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NYB0

  • Expression Region

    1-399aa

  • AA Sequence

    MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGG GTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYR LGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDADDVAILTYVKE NARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDA PVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAV KKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEE EEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFL ASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TERF2IP, also known as TEP1 or TRF2-interacting protein, is a critical component involved in maintaining telomere integrity and regulating cellular senescence. Its primary function centers around the shelterin complex, which protects telomeric DNA from damage and prevents it from being recognized as DNA double-strand breaks. Research has indicated that TERF2IP plays a significant role in the stabilization of telomeres, thereby influencing gene expression and cellular aging processes. The dysfunction or downregulation of TERF2IP is often associated with various age-related diseases and cancers, highlighting its importance in both aging biology and tumorigenesis. The study of TERF2IP recombinant protein offers valuable insights into its functional mechanisms and interactions within the shelterin complex, enabling researchers to explore potential therapeutic targets for diseases linked to telomere dysfunction. Understanding the protein's structure and interactions can reveal how it contributes to genomic stability and may lead to innovative strategies for cancer treatment and aging interventions. As research continues to uncover the multifaceted roles of TERF2IP, it presents a promising avenue for advancing our knowledge of telomere biology and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US