Analytical Data
-
Gene name
ZDHHC8
- Application
-
Alternative Names
ZDHHC8; KIAA1292; ZDHHCL1; ZNF378; Palmitoyltransferase ZDHHC8; Zinc finger DHHC domain-containing Protein 8; DHHC-8; Zinc finger Protein 378
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ULC8
-
Expression Region
1-42 aa
-
AA Sequence
MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
-
Molecular Weight
30.36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC8, a member of the ZDHHC family of palmitoyl acyltransferases, plays a crucial role in the post-translational modification of proteins through the addition of palmitic acid, a process known as palmitoylation. This modification is essential for various cellular functions, including protein localization, stability, and protein-protein interactions. Dysregulation of ZDHHC8 has been implicated in several diseases, including neurodegenerative disorders and cancer. Research on ZDHHC8 has gained momentum due to its potential as a therapeutic target and its involvement in the regulation of important signaling pathways. Studies have aimed to elucidate its molecular mechanisms, identify substrate proteins, and explore its role in cellular processes such as synaptic transmission and immune responses. The reconstitution of ZDHHC8 protein in vitro facilitates the examination of its enzymatic activity and substrate specificity, contributing to a deeper understanding of its biological significance and therapeutic potential. Overall, the ongoing research into ZDHHC8 promises to shed light on its contributions to human health and disease.
