Analytical Data
-
Gene name
ZDHHC7
- Application
-
Alternative Names
ZDHHC7; Palmitoyltransferase ZDHHC7; Acyltransferase ZDHHC7; Zinc finger DHHC domain-containing Protein 7; DHHC-7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NXF8
-
Expression Region
1-208 aa
-
AA Sequence
MLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV
-
Molecular Weight
48.62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC7, a member of the protein acyltransferase family, plays a crucial role in the post-translational modification of proteins through palmitoylation, which involves the addition of palmitic acid to cysteine residues. This modification is vital for regulating various cellular processes, including signal transduction, membrane trafficking, and protein stability. Dysregulation of palmitoylation has been linked to several diseases, including neurodegenerative disorders, cancer, and cardiovascular diseases. Research into ZDHHC7 has garnered attention due to its potential involvement in these pathological conditions as well as its role in the development and function of the nervous system. Given that ZDHHC7 is implicated in the palmitoylation of key proteins that influence neuronal signaling and synaptic plasticity, understanding its biochemical properties and regulatory mechanisms has significant implications for therapeutic strategies. Recombinant ZDHHC7 protein studies enable elucidating its enzymatic activity, substrate specificity, and interaction with other cellular components. This research could provide insights into the role of ZDHHC7 in health and disease, ultimately paving the way for novel interventions targeting aberrant palmitoylation processes in various disorders.
