Analytical Data
-
Gene name
FGF22
- Application
-
Alternative Names
FGF22；Fibroblast growth factor 22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HCT0
-
Expression Region
23-170aa
-
AA Sequence
MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQD SILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEE NGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor 22 (FGF22) is a member of the fibroblast growth factor (FGF) family, which plays a critical role in various biological processes, including neurodevelopment, tissue repair, and metabolic regulation. First identified in the context of the nervous system, FGF22 is primarily expressed in the brain and has been implicated in neuronal development and synaptic function. Research has shown that FGF22 is involved in the modulation of neuronal survival, differentiation, and plasticity, making it a key player in neurodegenerative diseases and neuroinflammation. Moreover, FGF22 has been linked to metabolic disorders such as obesity and diabetes, highlighting its importance beyond the nervous system. The recombinant production of FGF22 has gained attention for its potential therapeutic applications, particularly in regenerative medicine and neuroprotection. Understanding its molecular mechanisms and interactions can provide valuable insights into developing novel treatments for conditions associated with FGF22 dysregulation. As such, the study of FGF22 recombinant proteins not only furthers our knowledge of FGF family members but also opens new avenues for therapeutic interventions in various diseases.
