Analytical Data
-
Gene name
ZDHHC4
- Application
-
Alternative Names
Zinc finger DHHC domain-containing Protein 4; Zinc finger Protein 374; ZNF374
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPG8
-
Expression Region
1-344 aa
-
AA Sequence
MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQRAVHGLLHYLFHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEFDEVMFPKNVRCSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAIVSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYLAATNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE
-
Molecular Weight
66.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC4 (Zinc Finger DHHC-Type Palmitoyltransferase 4) is an enzyme that plays a crucial role in the post-translational modification of proteins through palmitoylation, a process that adds palmitic acid groups to cysteine residues. This modification is significant for the regulation of protein localization, stability, and function, influencing various cellular processes including signal transduction and membrane dynamics. Dysregulation of palmitoylation is linked to several diseases, including cancer and neurodegenerative disorders. Research on ZDHHC4 has garnered attention due to its specific involvement in the palmitoylation of critical signaling proteins and its potential implications in cellular signaling pathways. Understanding the structure and function of ZDHHC4 can provide insights into the mechanisms underlying these diseases and identify new therapeutic targets. Recent studies have focused on the recombinant expression of ZDHHC4 to investigate its enzymatic activity and substrate specificity, facilitating a more in-depth exploration of its role in cellular functions. This research not only enhances our understanding of ZDHHC4 but also contributes to the broader field of protein modification, offering potential avenues for therapeutic interventions in diseases associated with aberrant palmitoylation.
